General Information

  • ID:  hor004710
  • Uniprot ID:  Q6DUW9
  • Protein name:  Protein IDA-LIKE 2
  • Gene name:  IDL2
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  NA
  • Source:  Plant
  • Expression:  Expressed in leaves, buds, flowers, seedlings and seeds. Detected at the base of pedicel, in the floral and funicule abscission zones and in vascular tissues.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0010227 floral organ abscission
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GARTNTNVFNSKPHKKHNDAVSSSTKQFLGFLPRHFPVPASGPSRKHNDIGLLSWHRSSP
  • Length:  60
  • Propeptide:  MSSRNQRSRITSSFFVSFFTRTILLLLILLLGFCNGARTNTNVFNSKPHKKHNDAVSSSTKQFLGFLPRHFPVPASGPSRKHNDIGLLSWHRSSP
  • Signal peptide:  MSSRNQRSRITSSFFVSFFTRTILLLLILLLGFCN
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in floral abscission.
  • Mechanism:  IDL2 is only partially redundant with IDA.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DUW9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004710_AF2.pdbhor004710_ESM.pdb

Physical Information

Mass: 769995 Formula: C295H456N94O83
Absent amino acids: CEMY Common amino acids: S
pI: 12.14 Basic residues: 14
Polar residues: 21 Hydrophobic residues: 16
Hydrophobicity: -90 Boman Index: -14506
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 52
Instability Index: 6603.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 93.22

Literature

  • PubMed ID:  12972671
  • Title:  Inflorescence deficient in abscission controls floral organ abscission in Arabidopsis and identifies a novel family of putative ligands in plants.
  • PubMed ID:  18660431
  • Title:  The EPIP peptide of INFLORESCENCE DEFICIENT IN ABSCISSION is sufficient to induce abscission in arabidopsis through the receptor-like kinases HAESA and HAESA-LIKE2.